Protein Info for ABZR88_RS18020 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 164 (163 residues), 112.6 bits, E=8.8e-37

Best Hits

Swiss-Prot: 49% identical to DCDB_CLOBA: dCTP deaminase, dUMP-forming (dcd) from Clostridium botulinum (strain Alaska E43 / Type E3)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 85% identity to phe:Phep_0227)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Protein Sequence (178 amino acids)

>ABZR88_RS18020 dCTP deaminase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MILSDKRILEEIDRGNIIIEPYRSECLGTNSYDVHLGKYLATYRNRVLDAKLHNEIDYFE
IPKDGYVLHPGTLYLGVTLEYTETHRHVPFLEGKSSTGRLGIDIHATAGKGDVGFCNTWT
LEISCAQPVRIYAGMPIGQLIYFVVEGDIETTYNSKDNAKYNKPTTKPVESMMWKNTF