Protein Info for ABZR88_RS17715 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 175 (29 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 222 (207 residues), 65.3 bits, see alignment E=2.7e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>ABZR88_RS17715 acyltransferase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIIAKAPVVKKGIDRNLEALRGFAALVVVFNHIEALHKAFDANFLPTLTIVLAPNGHLFV
LVFFVLSGYVIGISHQEPMRGPVIGSYIKKRLLRIYPIYIIATLFALLITHYSFTGWDIA
CNFLMLQTLLAYPIFENGPTWSLHYEMVYYGIFIPISRFRVSPLLILGISLVLALGSAGI
FSAYFLGLSYWISGLCIARYFKNKSDGVAYNKLLSLLFLLLCLDQVLSRAGMPNLVKHLQ
YQLPVNHLFDWYHLQSPLLGSTRDLFFLPFYVFAVMIFAGINWRYERQCFGLINAIIASA
ITVSVNAMLDGHKANMGAYFIAIGYYLLFLLFWLVEGGWLALVSKPVIRFGSWIGGISYA
LYIVHAPILFVIGRFTFSDQVVTNYVIKVILLLSISTGFAWLLEKWFQPRIKQLLNRA