Protein Info for ABZR88_RS17425 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 3 to 173 (171 residues), 57.4 bits, E=3.9e-19
• TIGR01181: dTDP-glucose 4,6-dehydratase
  • amino acids 3 to 333 (331 residues), 473.7 bits, E=1.3e-146
• PF02719: Polysacc_synt_2
  • amino acids 4 to 174 (171 residues), 58.5 bits, E=2e-19
• PF01370: Epimerase
  • amino acids 4 to 248 (245 residues), 233.7 bits, E=6.3e-73
• PF16363: GDP_Man_Dehyd
  • amino acids 5 to 320 (316 residues), 323.8 bits, E=4.6e-100
• PF01073: 3Beta_HSD
  • amino acids 5 to 232 (228 residues), 61.8 bits, E=1.7e-20
• PF07993: NAD_binding_4
  • amino acids 6 to 185 (180 residues), 42 bits, E=2e-14

Best Hits

Swiss-Prot: 55% identical to RMLB_XANCB: dTDP-glucose 4,6-dehydratase (rfbB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 82% identity to psn:Pedsa_3848)

MetaCyc: 51% identical to dTDP-glucose 4,6-dehydratase (Aneurinibacillus thermoaerophilus L420-91)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (9/11 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Protein Sequence (350 amino acids)

>ABZR88_RS17425 dTDP-glucose 4,6-dehydratase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKKIIITGGAGFIGSHVVRRFVTQHPEYHIINLDKLTYAGNLANLKDIEGAPNYEFVKGD
IVDAAFIDQLFADKQPDAVIHLAAESHVDRSITNPTEFVMTNVIGTVNLLNAARNLWKGR
YDSTRFYHVSTDEVYGTLGEDGMFTEETAYDPHSPYSASKASSDHFVRAYQDTYGMDTVI
SNCSNNYGSYHFPEKLIPLAIHNIKQMKSIPVYGKGENVRDWLWVEDHARAIELIFHKAK
SGATYNIGGHNEWKNIDLIQLLCSILDKKLGRAEGTSAGLITYVTDRAGHDLRYAIDATK
LKTELGWVPSITFEEGLEKTVDWYLANQEWLDDVTSGHYQQYYSEQYADR