Protein Info for ABZR88_RS16915 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: nitrite reductase small subunit NirD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02378: nitrite reductase [NAD(P)H], small subunit
  • amino acids 8 to 113 (106 residues), 115.4 bits, E=6.1e-38
• PF13806: Rieske_2
  • amino acids 8 to 113 (106 residues), 100.2 bits, E=6.2e-33
• PF00355: Rieske
  • amino acids 8 to 103 (96 residues), 58.6 bits, E=4.8e-20

Best Hits

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 62% identity to dfe:Dfer_2057)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

• alkylnitronates degradation (1/2 steps found)
• nitrate reduction V (assimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Protein Sequence (116 amino acids)

>ABZR88_RS16915 nitrite reductase small subunit NirD (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQVVEAIEWTLACYSDDIPENGGACVKLGDEQIAVFNFNRRGEWYATQNLCPHKQQMVLS
RGMIGSSGEACEPKVACPFHKKTFSLLSGECLSGEDYQIKTYPIKVEDGKVYIGIV