Protein Info for ABZR88_RS16095 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: M20 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR01891: amidohydrolase" amino acids 19 to 379 (361 residues), 351.4 bits, see alignment E=3e-109 PF01546: Peptidase_M20" amino acids 75 to 388 (314 residues), 141.7 bits, see alignment E=3.1e-45 PF07687: M20_dimer" amino acids 192 to 283 (92 residues), 32.1 bits, see alignment E=9.8e-12

Best Hits

Swiss-Prot: 39% identical to ILL3_ORYSJ: IAA-amino acid hydrolase ILR1-like 3 (ILL3) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 73% identity to shg:Sph21_0672)

MetaCyc: 39% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>ABZR88_RS16095 M20 family metallopeptidase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIKEKIQQLTQDIFNDVVANRRHLHSHPELSFNEVQTSAFVAGKLDELGIPYVRMADNGL
VGLITGAKPSNNVVALRADMDALPITEANDVPYKSQNVGVMHACGHDVHTSSLLGTAKIL
TALKNDFGGTVKLIFQPAEEKLPGGASLMIKEGVLENPKPQAVMGQHVMPLIDAGKVGFR
VGKYMASTDELYVTVRGKGGHGAQPQQNVDPVIITAHILTALQQVVSRFSDPKNPCVLSF
GKVIANGATNVIPNEVYLEGTFRTMDEKWRAEAHKRMKKMAEGIAESMGATCEFNIMNGY
PFLINEEKVTRAARANAVDFLGEENVEDLDIWMAAEDFAYYSQVADSCFYRLGTRNEARG
ITSSVHTPTFDIDEDAFKVSTGLMAYLAVKQLGN