Protein Info for ABZR88_RS15805 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 67 (26 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 346 (341 residues), 107.2 bits, see alignment E=4.7e-35

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>ABZR88_RS15805 acyltransferase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKVFYKNLNSLRFIAAALVIIHHTEQYKWFNGLPHYFNHPVIILFGKLGVDIFFVLSGFL
ITSLLVIEKERFGRIAIKKFYMRRILRIWPLYFLIAGLSFFVWPHVPALHISQMPDPRAH
FWENLLLVVFFLPNVQLLLFRAIPYQAQAWSIGVEEQFYLVWPFIANWAKDKRKFRNTIA
VLLAGYLLIKAALVLIPAITHRYHKLDDMAYYISDIFQIDCMMIGALFGLFNFDAKAKQL
LTGKVLQVVVYVVTLALISAGAMFGYFYWEIYGVLFGIIIINLVNTNTSVISLEFKWMDY
LGKISYSMYMIHVLMINCVIRFFTHNTLLIYPLVFLCTIVVSIASYELFEKRFLHLKQSF
AKVQSGSDPKVGM