Protein Info for ABZR88_RS15600 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 6 to 112 (107 residues), 116.8 bits, E=1.8e-38

Best Hits

Swiss-Prot: 43% identical to GPO_LACLM: Glutathione peroxidase (gpo) from Lactococcus lactis subsp. cremoris (strain MG1363)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 63% identity to phe:Phep_1207)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (1/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.9

Protein Sequence (173 amino acids)

>ABZR88_RS15600 glutathione peroxidase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MDDKSIYQFRVKKLNGEEISLSEYKDKVLLIVNTASQCGFTPQLKELEELRRLYAGRDFE
VLAFPSNDFGAQEPLEGSGISKFCVMNFDAHFSLFEKTRVRGEYAHPLYKFLADKKQNGH
VHNAPRWNFHKYLIDQEGHVVDFFYPFTKPTSSKIRKKIDRLLSLQPQVLQHA