Protein Info for ABZR88_RS15360 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 36 (16 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 403 to 426 (24 residues), see Phobius details PF11700: ATG22" amino acids 6 to 430 (425 residues), 219 bits, see alignment E=1.2e-68 PF07690: MFS_1" amino acids 62 to 374 (313 residues), 33.6 bits, see alignment E=2.2e-12 amino acids 252 to 434 (183 residues), 34 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K06902, MFS transporter, UMF1 family (inferred from 57% identity to phe:Phep_1904)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABZR88_RS15360 MFS transporter (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQEKNNKRTIWAWCMFDWANQSYNMVITSTIFPSYYVGITRNKANGDTVSFFGHRFVNTV
LSNYILALSYLVVVALLPILTSIADYRGNKRLYLQLFTWLGSLSCAGLFMLQQGKPLEFP
MICFGLASIGYCGGFVFYNSYLPQIATVDQQDAVSAKGFIYGYVGSIVVQLICFVFVLFY
DKIGITQDRACQISFLVVFVWWIGFSFIAFRRLPKGWPNAGAHNYNVLTGGFKELAKVFG
KIRQMPLLKRFLSAFFFYSVGVQTIMLVAANFAAKELHMPDEHLIVIILIIQVVAVGGAV
VASKSSEKFGNTTTLVWLVTVWTVLCACVSFITTEAQFFVAAAVVGVVMGGVQSLSRSTY
SKYLPPNIPDTASFFSFYDVTEKLSIVVGLFCFGYVESRTHQMRVAALTLDGFFALGLIL
LVALLVKEVKKKRNTVEAVA