Protein Info for ABZR88_RS15340 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13637: Ank_4" amino acids 23 to 68 (46 residues), 31.8 bits, see alignment E=3.6e-11 amino acids 59 to 105 (47 residues), 30 bits, see alignment E=1.3e-10 amino acids 93 to 139 (47 residues), 25.7 bits, see alignment E=3e-09 PF12796: Ank_2" amino acids 24 to 114 (91 residues), 58.9 bits, see alignment E=1.6e-19 amino acids 112 to 172 (61 residues), 27.9 bits, see alignment E=7.3e-10 PF13857: Ank_5" amino acids 38 to 93 (56 residues), 34 bits, see alignment E=7.6e-12 amino acids 105 to 159 (55 residues), 32.9 bits, see alignment E=1.6e-11 PF00023: Ank" amino acids 51 to 83 (33 residues), 21.9 bits, see alignment 4e-08 amino acids 85 to 117 (33 residues), 16.7 bits, see alignment 1.9e-06 amino acids 118 to 149 (32 residues), 21.2 bits, see alignment 6.9e-08

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>ABZR88_RS15340 ankyrin repeat domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKKSLLLISPILLLSHKLFAQNIFTAVQDNDIPAVKYLLTKGVDPASKDNNGASPLIFAV
SHGNDRAVKLILQSNQININAQDGDGNTALITACAGKHDDQVAMLLNHYPELNKINKQGY
TALTTAVNANDAEAVKMLLAYGADKKHQDANHKLAIDYARELHEDEIVALLGGGAPANVT
AGR