Protein Info for ABZR88_RS15245 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF01547: SBP_bac_1" amino acids 23 to 158 (136 residues), 39.2 bits, see alignment E=8.8e-14 PF13416: SBP_bac_8" amino acids 25 to 306 (282 residues), 40 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 72% identity to phe:Phep_2756)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>ABZR88_RS15245 ABC transporter substrate-binding protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MSQNILLKGITWNHSRGFVPMTATAQRFSELHPNVNITWEKRSLQQFADLSIQQLAEIYD
LLVIDHPWAGFASKTKSILPFDEYLSTEFLADQAENTVGQSHESYSFDGHQWALAIDAAT
PVAASRPDLLAQHGVALPKTFDDLLALAKKGLVALPGIPIDSLMQYYTFCCSLGEDPCQG
DVVVSEEIGVKALKMYHELCQYIDPACFGRNPIQTYEAMTLTDEIAYCPFGYGYTNYSRD
GYARKLLHFHDMITLDGKTNLRSTLGGTGLAVSSKCEHVDVAMKYAEFVASPACQIGLYT
DNGGQPGHLKAWTDAANNAKTYNYFANTLPALQRAYLRPRYHGSMFFQDHAGDVVRDYLM
KGGDELQVLAELNALFAESKQKVHTV