Protein Info for ABZR88_RS15195 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: DeoR/GlpR family DNA-binding transcription regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF01022: HTH_5" amino acids 5 to 50 (46 residues), 28.3 bits, see alignment 4e-10 PF08220: HTH_DeoR" amino acids 6 to 59 (54 residues), 55.4 bits, see alignment E=1.3e-18 PF00455: DeoRC" amino acids 75 to 232 (158 residues), 168.4 bits, see alignment E=3.7e-53

Best Hits

KEGG orthology group: None (inferred from 81% identity to phe:Phep_2797)

Predicted SEED Role

"Transcriptional repressor of the fructose operon, DeoR family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABZR88_RS15195 DeoR/GlpR family DNA-binding transcription regulator (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLPNQRRDKILELLKEDGSAKVIDLARIFKVTEVTVRQDLEKMEKDGLISREHGGAYIKD
IHDQVRAFSLTHQENLDKKELIANKCLEFIESGDSIILDSGSTTTEIAKKLKGFKNLTVI
TNALNIATMLGTEPGIELIVTGGEFKPPTLSLTGQKAADFFKGINVQKLFLATAGLSLKA
GLTYPSISDIVVKKAMIDAAETVYLVADSTKIGKSSFASLGALSLINYIITDAGIEAHHK
AVLEDNDIELIIAE