Protein Info for ABZR88_RS15055 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 32 to 47 (16 residues), see Phobius details PF00456: Transketolase_N" amino acids 34 to 268 (235 residues), 81.8 bits, see alignment E=1.2e-26 PF09364: XFP_N" amino acids 91 to 224 (134 residues), 26.4 bits, see alignment E=7.8e-10 PF02775: TPP_enzyme_C" amino acids 117 to 195 (79 residues), 24.9 bits, see alignment E=4e-09 PF00676: E1_dh" amino acids 117 to 222 (106 residues), 37.4 bits, see alignment E=3.8e-13 PF13292: DXP_synthase_N" amino acids 126 to 182 (57 residues), 30.2 bits, see alignment E=7.1e-11

Best Hits

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 67% identity to cts:Ctha_2089)

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>ABZR88_RS15055 transketolase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MDSTQNYNPEQLTATAFKVREHIIRMSTDGGCFIGASLSAVDLIVYLYNNFLNITADNLD
DENRDYLFLSKGHDVPALYGTLAELGILETERLQNHLSINDHIYWHPNTKIPGIEFHSGS
LGHLPSVAIGVAMDIKLRGGNNKVICILGDGELNEGTCWEAMLVANAYKLDNLIFVVDRN
QFQANIRTEELIPLEPLADKFAAFGAAVKRIDGHNFDALHEAFSAYPFHPGKPNVVIADT
MRGKGLPSIQERADRWFCNFSGDEIDQLLLELHGNHTTQLTSETLIVR