Protein Info for ABZR88_RS14785 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 159 to 186 (28 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 39 to 299 (261 residues), 118.2 bits, see alignment E=2.7e-38 PF03631: Virul_fac_BrkB" amino acids 47 to 300 (254 residues), 212 bits, see alignment E=6e-67

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 64% identity to phe:Phep_1844)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>ABZR88_RS14785 YihY/virulence factor BrkB family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MEWLHRFLSRFRFYQYFLDWTKSVILPGFRPLPLYTVASFFFKEIKQDSLINRASSLAYS
FMLAIFPVIIFLFTLIPYIPIRGFQDTLLNVIATILPTNAYEAFYSTIEEIVKIHNFSLL
SFGFLSATIFATNGVIKLMRAFNKSSLVAESRTWLKKRWIALVLTIFIAFTLIVAISILI
IGQAVISYIQHGLHSKSSVWVYIIMFSRWIIVVLLFFATVSILYRYAPAHKRKWKFLSPG
SILATFLAVFTSLGFSFYINNFSSYNKIYGSIGTLIVVMLWLYLNSLIILIGFELNASIE
LSKRNVKIVKPRFNTFKGAKSSEQ