Protein Info for ABZR88_RS14010 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF00186: DHFR_1" amino acids 3 to 159 (157 residues), 217.4 bits, see alignment E=4.4e-69

Best Hits

Swiss-Prot: 47% identical to DYR_BACSU: Dihydrofolate reductase (dfrA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 68% identity to phe:Phep_1421)

MetaCyc: 36% identical to dihydrofolate reductase (Escherichia coli K-12 substr. MG1655)
Dihydrofolate reductase. [EC: 1.5.1.3]

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>ABZR88_RS14010 dihydrofolate reductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIVSAIVAIGQNNAIGKNNQLLWHLPNDLKHFKDITSGHTIIMGRKTFDSLGKPLPKRRN
IIITRQDTSIPGAEVVHTVEEALALCEGEEEVFIGGGAEIYKMAMPKTDRIYLTIVHQSF
DADAYFPEIDQNEWKETERENHAADEKNAIPYSFITLDRA