Protein Info for ABZR88_RS14000 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 6 to 251 (246 residues), 155.5 bits, see alignment E=1.1e-49 PF00288: GHMP_kinases_N" amino acids 82 to 139 (58 residues), 42 bits, see alignment E=1e-14 PF08544: GHMP_kinases_C" amino acids 201 to 256 (56 residues), 37.8 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 54% identical to ISPE_BACFN: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 61% identity to psn:Pedsa_2042)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABZR88_RS14000 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIAFPNAKINIGLNITERRADGYHNLETIFYPINITDALEIVPANELSFEASGLGIPGQV
EDNLCIKGYHLLKADFDLPPVKIHLHKHIPIGAGLGGGSSDAAFFFKLMNKEFSLNLSNE
QMRDYVRVLGADCAFFIEGKPVYAFEKGDQFEPVDLDLSVYHLVLVMPPAHVSTAEAYRG
VKPQPSERSLKELVSLPVGDWKQYIRNDFETSIFKNHPVIRGVKSALYEAGALYACMSGS
GASVFGVFKERPDLSALEKDNQVFYNV