Protein Info for ABZR88_RS13720 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: LytTR family DNA-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 3 to 111 (109 residues), 42.2 bits, E=8.4e-15
• PF04397: LytTR
  • amino acids 154 to 251 (98 residues), 51.7 bits, E=8.7e-18

Best Hits

KEGG orthology group: None (inferred from 65% identity to cpi:Cpin_6060)

Predicted SEED Role

"Two-component system response regulator" in subsystem Streptococcal Mga Regulon or Two-component regulatory systems in Campylobacter

Protein Sequence (255 amino acids)

>ABZR88_RS13720 LytTR family DNA-binding domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNIIIIEDELRTAKSLENIILGLRPEAKIIGQYQSVERSVEALSGSLQPDLIFMDIQLAD
GLSFEIFKSVKITCPVVFCTAFDEYSLEAFKRNGVDYVLKPFSKEDIQEAFRKVDELKNF
FQQKVVPDLGDLLSKLGGASPAGKTSFLVFKNQKYTTVHTDNIAFFYIRNEGTSIMGFDG
QEYAISQSLDQITAAVSSKQFFRVNRQYLVNFKAIKEVEHYFLRKLYVKLIIETPDKLLI
NKEKSSAFLSWMEDR