Protein Info for ABZR88_RS13265 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 4 to 152 (149 residues), 179.8 bits, see alignment E=2.2e-57 PF01625: PMSR" amino acids 5 to 152 (148 residues), 198.3 bits, see alignment E=4.2e-63

Best Hits

Swiss-Prot: 71% identical to MSRA_MYCPA: Peptide methionine sulfoxide reductase MsrA (msrA) from Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 85% identity to phe:Phep_3784)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>ABZR88_RS13265 peptide-methionine (S)-S-oxide reductase MsrA (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQTEKAILAGGCFWGVEELIRQQPGVISTVVGYTGGDVPNATYRNHGTHAEGIAITFDPS
VLSYRKLLEYFFQIHDPTTRNRQGNDIGTSYRSAIFYLNEAQKDTAIQLITEMEASGKWP
GKIVTEVVPAGDFWDAEEEHQDYLQKQPWGYTCHFERPEWTL