Protein Info for ABZR88_RS12245 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: multidrug resistance efflux transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 150 (16 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details PF13536: EmrE" amino acids 46 to 307 (262 residues), 232.3 bits, see alignment E=3.8e-73

Best Hits

KEGG orthology group: None (inferred from 69% identity to cpi:Cpin_1766)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABZR88_RS12245 multidrug resistance efflux transporter family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MTAQKKTLIAIAWGIGASVFLSSTFIINSLISGSGGYWAWTAALRSTFLIPILGGVLLFK
RQLWSTLKTIGQYPMLFFKWGTIGFGVLYTFLALASLWAPGWLVAAGFQLNILAGILLAP
LIYPDHRRAIPKRPLLLTLLILVGVVMMQFEKLRSLDHAGSMLLSLGLVLVGAIVWPLGN
RKLLVDLEHKKVELNALQRVLGMTIGCLPLLIVLCVVGYVKSGAPTYTQCQASLLSAIFS
GLIGGVSFYQATQLVSKNTVALAAIEATQALEILFTLIGEMVLKGVGLPGLYARLGFVVI
TAGLLIHFWNTWNHGRSEHQKERLLAAELSSLAA