Protein Info for ABZR88_RS11785 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 5 to 198 (194 residues), 168.2 bits, E=3.1e-53
• PF08659: KR
  • amino acids 8 to 184 (177 residues), 58.3 bits, E=1.9e-19
• PF13561: adh_short_C2
  • amino acids 14 to 252 (239 residues), 188.3 bits, E=3.5e-59

Best Hits

KEGG orthology group: None (inferred from 67% identity to sli:Slin_0484)

MetaCyc: 34% identical to BadH (Rhodopseudomonas palustris)
R267-RXN

Predicted SEED Role

"short-chain alcohol dehydrogenase-like protein"

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (1/9 steps found)

Protein Sequence (253 amino acids)

>ABZR88_RS11785 SDR family NAD(P)-dependent oxidoreductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNNNKIALITGGSRGLGKNMAQHLAQKGINVVLTYNNKKDEAEAMVAELEQAGVKAAALQ
LNAGDVKSFDGFVAELKESLSVKFGTEKIDFLVNNAGFGLHKSFAETTEEEFDNIINIHF
KGVFFLTQKLLNVISDGGRIINISSGLARFSMVGTSAYGAAKGAIETLSRYMAKELGPRG
IAVNVVAPGAIATDFSGGRVRDNAEVNKMVSSVTALGRAGVPDDIGGIVAFLCTEDARWI
NAQRLEASGGMNI