Protein Info for ABZR88_RS11700 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: SGNH/GDSL hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF17996: CE2_N" amino acids 32 to 138 (107 residues), 109 bits, see alignment E=2e-35 PF00657: Lipase_GDSL" amino acids 146 to 288 (143 residues), 36.6 bits, see alignment E=8.1e-13 PF13472: Lipase_GDSL_2" amino acids 148 to 308 (161 residues), 37 bits, see alignment E=7.8e-13

Best Hits

KEGG orthology group: None (inferred from 53% identity to ppn:Palpr_2939)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABZR88_RS11700 SGNH/GDSL hydrolase family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MRKLILATLLFILSFSTRADVIVKGDDAHIHYMGRIGKADDASVLSWPGTSASINFTGSS
VTATLEDQYGENYYNVIVDGQVTKVLHLSNIKKSYLLAEGLSTGRHQLTLFKRTEWVFGK
TLFYQFAIADGGEILPAPETKSCKIEYFGDSITCGYAVEDSSGRDRGIGQFENNYLSYAA
LVARHYNAEYSCIARSGIGLTLSYYHQIMPEMYHLTDGGDPQSEWNFNKFTPDIVVINLF
QNDAGLFYRSDLPEFKARFGDEAPTPEKIIKAYQDFIKQLRSQYPQASIICTLGSMDAVR
TGSPWPDYVKKAAAGLGDKKVFAYIYNYKNTPGHPNVAQQQAMANQLIAFIDKHAPLTSK