Protein Info for ABZR88_RS10590 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 1 to 380 (380 residues), 469.4 bits, E=4.3e-145
• PF02670: DXP_reductoisom
  • amino acids 4 to 130 (127 residues), 154.7 bits, E=3.2e-49
• PF08436: DXP_redisom_C
  • amino acids 144 to 227 (84 residues), 138.1 bits, E=1.3e-44
• PF13288: DXPR_C
  • amino acids 259 to 374 (116 residues), 128 bits, E=3.3e-41

Best Hits

Swiss-Prot: 62% identical to DXR_BACTN: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 70% identity to psn:Pedsa_0615)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (8/12 steps found)
• taxadiene biosynthesis (engineered) (8/13 steps found)
• methylerythritol phosphate pathway I (5/9 steps found)
• isoprene biosynthesis I (5/10 steps found)
• superpathway of ergosterol biosynthesis II (7/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (391 amino acids)

>ABZR88_RS10590 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKNIAVLGSTGSIGTQTLEVISENPGLFRAYAITAQNSADLLIEQALQFNPAHVVICNEE
KYQQVKQTLAHTSIQVHCGAEAIKEIVTHPEIDTVLTAMVGFAGLEPTIEAIKAGKEIAL
ANKETLVVAGDLITDLARKHHVSILPVDSEHSAIFQCLVGEQYDEIEKLILTASGGPFRG
KTADVLTNVTRKEALKHPNWVMGAKITIDSATLMNKGLEVIEAKWLFNVNVDQIEVIVHP
QSIVHSLVQFRDGSLKAQMGLPDMKLPIQYALGHPQRIANNYKRFSFLDYPSLSFEQPDL
KTFRNLALCFDALKQGGNMPCIVNAANEVAVAGFLKDETGFLQMSDIIETCMTKMPYIAA
PTMQDYLNTDKETRILAQNLIKQMPLKAVTI