Protein Info for ABZR88_RS10130 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: YqgE/AlgH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF02622: DUF179" amino acids 17 to 171 (155 residues), 153.9 bits, see alignment E=1.9e-49

Best Hits

Swiss-Prot: 43% identical to Y495_SALRD: UPF0301 protein SRU_0495 (SRU_0495) from Salinibacter ruber (strain DSM 13855 / M31)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 57% identity to phe:Phep_1896)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>ABZR88_RS10130 YqgE/AlgH family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLSSIPAAVGRLLISEPFMMDPNFKRSVILITEYHEEGAVGFVLNHQSDNLLGDLLPDVS
YSELPVYLGGPVAADTLHFIHRCPEKIQGGLEIAKGVYWGGDFDTVKNLINNYQLNPDEI
KFFTGYSGWTAGQLDTELQDDTWIVASDYKPEMIFADSEHNLWREVVISLGQRYAHIANF
PENPMLN