Protein Info for ABZR88_RS10075 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: peptide-methionine (R)-S-oxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00357: methionine-R-sulfoxide reductase
  • amino acids 43 to 167 (125 residues), 169.3 bits, E=2.1e-54
• PF01641: SelR
  • amino acids 47 to 166 (120 residues), 174.6 bits, E=3.6e-56

Best Hits

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 74% identity to cpi:Cpin_6049)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Protein Sequence (170 amino acids)

>ABZR88_RS10075 peptide-methionine (R)-S-oxide reductase MsrB (Mucilaginibacter yixingensis YX-36 DSM 26809)
MRTLKVLALLLCLSVSAFAQHLKTNGHANNPYYSNTDTKKLNVSNAEWKKILSPDLYAVA
REQATERAFTGKYWNSSAKGTYYCAVCGNKLFRSDAKFASDCGWPSFFEAVRKDAVIYRE
DDSYDMQRTEVICARCGSHLGHIFDDGPAPTYKRFCMNSVSLDFEPDRAL