Protein Info for ABZR88_RS07990 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: Holliday junction branch migration DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF05496: RuvB_N" amino acids 23 to 181 (159 residues), 258.4 bits, see alignment E=5.3e-81 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 27 to 329 (303 residues), 464.5 bits, see alignment E=6.7e-144 PF00004: AAA" amino acids 58 to 181 (124 residues), 69.8 bits, see alignment E=8.3e-23 PF17864: AAA_lid_4" amino acids 184 to 257 (74 residues), 102.1 bits, see alignment E=2.7e-33 PF05491: RuvB_C" amino acids 258 to 328 (71 residues), 93.6 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 76% identical to RUVB_FLAPJ: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 86% identity to shg:Sph21_2470)

MetaCyc: 59% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ABZR88_RS07990 Holliday junction branch migration DNA helicase RuvB (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNEHLNPERDNISPAEYDIEKVLRPQAFEDFTGQQKILTNLKVFVQAARQRGEALDHVLL
HGPPGLGKTTLSHIIANEMGTGIKITSGPVLDKPGDLAGLLTNLEAGDILFIDEIHRLSP
LVEEYLYSAMEDFKIDIMLESGPNARSVQLSLNPFTLIGATTRSGLLTAPLRARFGINAR
LEYYDAKLLTTIVLRSSSILKTPIEETGAFEIARRSRGTPRIANALLRRTRDFAQIKGNG
TVDRDIAQYALNALNVDEHGLDEMDNKILLTIIEKFKGGPVGLKTIATAVGEDEGTIEEV
YEPFLIQEGFLMRTSRGREATEHAYRHLGLTKLGGQNSLF