Protein Info for ABZR88_RS07005 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00793: DAHP_synth_1
  • amino acids 16 to 253 (238 residues), 127.4 bits, E=4.9e-41
• PF01817: CM_2
  • amino acids 279 to 356 (78 residues), 78.9 bits, E=3.1e-26

Best Hits

KEGG orthology group: K04516, chorismate mutase [EC: 5.4.99.5] (inferred from 75% identity to phe:Phep_1512)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta (EC 2.5.1.54) / Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Phenylalanine and Tyrosine Branches from Chorismate (EC 2.5.1.54, EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• L-tyrosine biosynthesis III (4/4 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• L-phenylalanine biosynthesis II (3/4 steps found)
• L-tyrosine biosynthesis II (3/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (3/5 steps found)
• bacilysin biosynthesis (1/10 steps found)
• superpathway of chorismate metabolism (36/59 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.54 or 5.4.99.5

Protein Sequence (376 amino acids)

>ABZR88_RS07005 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase type II (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKIDLNVQPLSSWINTGKQPLLIAGPCSAETEDQLVATAHLLAKTGKVTALRAGIWKPRT
RPGEFEGIGSIGLKWLQRAKEETGLPVAIEVATGKHVEEALAAGVDILWVGARSTVNPFT
VQEIADALKGVDIPVMVKNPVNPDLSLWIGALERINNAGITKLAAIHRGFSSYEKSAFRN
EPMWDMAINLKTHAPHLPIINDPSHISGNRDLIQYVAQKALDLDMQGLMIESHIDPSVAW
TDAKQQVTPSHLADIIDALTLRKPETANTEVSSKLDELRKQIDKIDDLLIQKLAERMQIV
EKIGQYKKDNGITILQVGRWDEILQKRTGYAKALKLNPEFTEKMLEMIHSESIRKQTEIM
SKEQAEGQAQEKMTHA