Protein Info for ABZR88_RS06640 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: RDD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 77 to 101 (25 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details PF14237: GYF_2" amino acids 10 to 53 (44 residues), 40.7 bits, see alignment 1.6e-14 PF06271: RDD" amino acids 71 to 196 (126 residues), 85.4 bits, see alignment E=4.5e-28

Best Hits

KEGG orthology group: None (inferred from 51% identity to phe:Phep_3457)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>ABZR88_RS06640 RDD family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MTHKLEKYLLVINGRPEGPFAVDELRQRGLKPGDFVRTDGMADYKEAHEVPELRALFGFK
KQTVAPQYFGSFDQRLLASVIDWLLVSAGFAIVALCIVLAIQNQMMRSVIAVSLAVIIPV
ANFIYHVAMESSAQQATYGKQILKIKVTDMEGRRITTNRAVGRNLARVFSVCTFYLGYLY
SFFNKKQQCLHDVVAGTLVVKDRLI