Protein Info for ABZR88_RS04375 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF05175: MTS" amino acids 53 to 129 (77 residues), 23.7 bits, see alignment E=9.7e-09 PF13489: Methyltransf_23" amino acids 58 to 164 (107 residues), 50.3 bits, see alignment E=6.7e-17 PF13847: Methyltransf_31" amino acids 61 to 167 (107 residues), 40.6 bits, see alignment E=6.8e-14 PF13649: Methyltransf_25" amino acids 64 to 154 (91 residues), 51 bits, see alignment E=6.1e-17 PF08241: Methyltransf_11" amino acids 66 to 158 (93 residues), 50.9 bits, see alignment E=6.1e-17 PF08242: Methyltransf_12" amino acids 66 to 155 (90 residues), 43.6 bits, see alignment E=1.2e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>ABZR88_RS04375 class I SAM-dependent methyltransferase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLSALKHILPTHLFHKPIPEKEAGEAYNIWSVQYDAQPANLMMDLDEQVFGRLLDQVDLT
GKSVADIGCGTGRHWAKMLQHHPVRLAGFDVSAGMLERLRAKFGSAETHLINDNLFSDIP
SGSFDVIVSTLTMAHIQNLEEALLSWSCILKQKGDILITDFHPDALATGGKRTFKSGNQT
IAIKNFVHHVNRIIDILAVSGFEVTYSEQIPVDESMKHYYEQYNALHVYEKFEGMPMIYG
LHLQRK