Protein Info for ABZR88_RS04280 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: M20 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01546: Peptidase_M20
  • amino acids 68 to 351 (284 residues), 71.4 bits, E=1.1e-23
• PF07687: M20_dimer
  • amino acids 169 to 268 (100 residues), 61 bits, E=9.7e-21

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 78% identity to phe:Phep_4203)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)
• superpathway of arginine and polyamine biosynthesis (9/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Protein Sequence (354 amino acids)

>ABZR88_RS04280 M20 family metallo-hydrolase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MANIDYLHGQAVGLLQQLIRIPSFSREEDKTGDVIEHFLDLQGIKTERKLNNIWARNKHF
DPAKPTILLNSHHDTVKPNSGYTRDPFDAAIEDGILYGLGSNDAGGCLVSLIATFLHFYD
RADLKYNFCLATTAEEEISGVNGLELIIPDLGDLAFGIVGEPTQMHLAIAEKGLMVLDCT
AHGKAGHAAREEGENAIYKALTDIEWFRNFRFPKESEVFGPVKMSVTIINAGSQHNVVPA
SCVFTVDVRVTDAYRNEEVLDIIREHVTCEVKPRSIRLKPSSIDKQHPIVQAGIALGRNT
YGSPTTSDQSLLDIPSLKIGPGDSARSHTADEFVFVDEIREGIEIYIKMLEAIV