Protein Info for ABZR88_RS04035 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00444: MazG family protein" amino acids 24 to 265 (242 residues), 273.7 bits, see alignment E=7.9e-86 PF03819: MazG" amino acids 36 to 108 (73 residues), 84.7 bits, see alignment E=4.2e-28 amino acids 171 to 234 (64 residues), 23 bits, see alignment E=7.8e-09

Best Hits

Swiss-Prot: 41% identical to MAZG_THEMA: Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG (mazG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 78% identity to phe:Phep_1231)

MetaCyc: 39% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.9

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABZR88_RS04035 nucleoside triphosphate pyrophosphohydrolase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MPLLPPPSANTAATAFERLLHIMDDLRTNCPWDMKQTMQTLRHLTIEETYELSDAILDGD
MTEIKKELGDIMLHLVFYARIGSETNDFDITAVLNGICDKLINRHPHIYSDTEANNEEEV
KRNWEKIKLKEGNKSVLGGVPASLPALVKASRIQEKARGIGFDWEHKHQVWEKVEEEMQE
FRNEFNVEDAAEIDLERAEGEFGDLLFSLINYARFININPEDALEKTNRKFIKRFQYLEQ
KASENGLNLQDMTLAEMDVFWNEAKKI