Protein Info for ABZR88_RS02760 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: pyridoxal phosphate-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to BIOF_CHRVO: 8-amino-7-oxononanoate synthase (bioF) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 53% identity to chu:CHU_2978)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

biotin biosynthesis I (13/15 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
biotin biosynthesis II (4/6 steps found)
8-amino-7-oxononanoate biosynthesis II (1/2 steps found)
8-amino-7-oxononanoate biosynthesis III (1/2 steps found)

KEGG Metabolic Maps

Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>ABZR88_RS02760 pyridoxal phosphate-dependent aminotransferase family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNKVQAFIQQSLQARKTAGNYREQKPATQLADFCSNDYLGFARSATLKQRVDDELRALPS
QNGSGGSRLLAGNTAYAEALENQIAQTHGFEAALLYNSGYDANVGLFSSLPQRGDTVITD
ELIHASIIDGIRLSNANRYTFKHNDLSALEQKLKNAAGRVYVAVESIYSMDGDRAPLAAI
AQLAAQYDAALIVDEAHATGVFGYGLVETAGLQQQVFAKIITYGKAMGCHGAAIAGSHLL
HDYLVNFSRSFIYTTAAPLHQLTTIKMAYQLLESSSAQTEKLHQHINRFKSKVSASVQII
PSDSAIQCIVAGSNEKARAMASHLQTNGFDVRPVLSPTVAAGTERLRICLHAFNTDGEID
TLADLINNFTL