Protein Info for ABZR88_RS02095 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 163 to 184 (22 residues), see Phobius details PF07638: Sigma70_ECF" amino acids 6 to 158 (153 residues), 33 bits, see alignment E=1.5e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 167 (156 residues), 70.5 bits, see alignment E=6.4e-24 PF04542: Sigma70_r2" amino acids 17 to 81 (65 residues), 31.9 bits, see alignment E=2.3e-11 PF08281: Sigma70_r4_2" amino acids 114 to 164 (51 residues), 39.9 bits, see alignment E=6.4e-14 PF04545: Sigma70_r4" amino acids 119 to 165 (47 residues), 27 bits, see alignment E=6.6e-10 PF00196: GerE" amino acids 127 to 166 (40 residues), 38.5 bits, see alignment 1.7e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 40% identity to phe:Phep_0954)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>ABZR88_RS02095 RNA polymerase sigma factor (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLLRWSEGDDGAFNAIYHKYALKLLAIALDKTRDRVMAEEIVQDAFIAFHKLQTQATSIN
SVFAFLYIVVKNKILDTHRQSSTYKRYQEDFGHYFNDVDNSTQALIETRDLERLLSDEIA
KLPPQCRRVLEMKQQGAMNKEIAQGLNISENTVEQHVRKALRLLRVAFVNHDVLTVSAIF
YLLLKR