Protein Info for ABZR88_RS01900 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: ribonucleoside-diphosphate reductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03477: ATP-cone
  • amino acids 1 to 88 (88 residues), 61.7 bits, E=1.2e-20
• PF00317: Ribonuc_red_lgN
  • amino acids 142 to 212 (71 residues), 83.2 bits, E=1.6e-27
• TIGR02506: ribonucleoside-diphosphate reductase, alpha subunit
  • amino acids 145 to 742 (598 residues), 709 bits, E=2.6e-217
• PF02867: Ribonuc_red_lgC
  • amino acids 216 to 738 (523 residues), 715.1 bits, E=8e-219

Best Hits

Swiss-Prot: 66% identical to RIR1_YEAST: Ribonucleoside-diphosphate reductase large chain 1 (RNR1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K10807, ribonucleoside-diphosphate reductase subunit M1 [EC: 1.17.4.1] (inferred from 85% identity to phe:Phep_0691)

MetaCyc: 66% identical to ribonucleoside-diphosphate reductase, large subunit R1 (Saccharomyces cerevisiae)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Protein Sequence (792 amino acids)

>ABZR88_RS01900 ribonucleoside-diphosphate reductase subunit alpha (Mucilaginibacter yixingensis YX-36 DSM 26809)
MFVIKRDGKRESVKFDKITARVEKLCYGLNPAHVDPIDVAKKVIEGLFDGVTTSELDNLA
AETAASLTTKHPDYALLASRIAVSNLHKNTVKSFSETMRMLYEYVDPKNGNPAALIADDV
HEIIQANAEILDSSIIYDRDFGFDYFGFKTLEKSYLLKLDGKIAERPQHLFMRVSVGIHK
EDIESAIATYNLMSERWFTHATPTLFNSGTPKPQMSSCFLLSMQGDSIDGIYDTLKQTAK
ISQSAGGIGLSIHNIRATGSYISGTNGTSNGIIPMLRVFNDTARYVDQGGGKRKGAFAIY
LEPWHADIFEFLDLRKNHGKEEMRARDLFYALWVSDLFMQRVEANEDWSLFCPNEAPGLA
DCFGDEFVKLYTQYEKEGRARRTVKAQELWFAVLDAQVETGTPYLLYKDAANSKSNQQNL
GTIKSSNLCTEIIEYTSDKEVAVCNLASLALPRYVINGVFDHQKLYEVTYQATINLNRII
DNNYYPVEEARYSNLRHRPIGLGVQGLADTFILLRMPFESEDAKQLNKEIFETIYFAAMT
ASKDMAIKDGAYETFQGSPLSKGQFQFDLWGVKPESGRWDWENLRLDVMNHGVRNSLLVA
PMPTASTSQILGNNECFEPYTSNIYTRRVLSGEFIIVNKFLLRDLVGLGLWTPAMKDKII
AANGSIQDIAEIPQDIKDLYKTVWEIKMRNIIDMAADRGAYICQSQSLNLFINSPNASKL
TSMHFYAWKKGLKTGMYYLRTQAASQAVKFTVENQGGKNMDPVIPAVVESVVDEIPAGPT
CSMEEGCVTCSA