Protein Info for ABZR88_RS01600 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00517: acyl carrier protein
  • amino acids 1 to 76 (76 residues), 109.3 bits, E=3.3e-36
• PF07377: DUF1493
  • amino acids 1 to 55 (55 residues), 25.5 bits, E=1.4e-09
• PF00550: PP-binding
  • amino acids 7 to 73 (67 residues), 61 bits, E=1.1e-20

Best Hits

Swiss-Prot: 82% identical to ACP_BACV8: Acyl carrier protein (acpP) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02078, acyl carrier protein (inferred from 96% identity to shg:Sph21_1356)

MetaCyc: 62% identical to acyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

Protein Sequence (78 amino acids)

>ABZR88_RS01600 acyl carrier protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MSDIASRVKAIIVEKLGVDESEVTPEASFTNDLGADSLDTVELIMEFEKEFNVAIPDDQA
ETIGTVGQAIAYLEKNVK