Protein Info for ABZR88_RS01405 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  • amino acids 9 to 322 (314 residues), 485.5 bits, E=2.7e-150
• PF00676: E1_dh
  • amino acids 17 to 313 (297 residues), 337.2 bits, E=1.1e-104
• PF02775: TPP_enzyme_C
  • amino acids 93 to 237 (145 residues), 27.6 bits, E=3.6e-10
• PF13292: DXP_synthase_N
  • amino acids 120 to 185 (66 residues), 21.3 bits, E=2.3e-08

Best Hits

Swiss-Prot: 58% identical to ODPA_RICFE: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 78% identity to phe:Phep_0171)

MetaCyc: 47% identical to pyruvate dehydrogenase E1 component alpha subunit (somatic) (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (1/4 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Protein Sequence (331 amino acids)

>ABZR88_RS01405 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha (Mucilaginibacter yixingensis YX-36 DSM 26809)
MGSIAITKDTYLMWYESMLLMRRFEEKSGQLYGQQKIRGFCHLYIGQEAVLAGAMSVLRH
EDAMITAYRDHAHALAKGTTPNAVMAELYGKATGCSKGKGGSMHMFDKENHFYGGHGIVG
GQVPLGAGIAFAEKYKGTDNLSVAYMGDGAVRQGALTETFNMAALWKLPVIFVCENNGYA
MGTSVERTTVQTDIYKLGLPYGIPSSPVDGMDPVAVHNAMDEAAQRARAGEGPTFLEMRT
YRYKGHSMSDPQKYRTKEELESYKAKDPLEAVKQTILKEKYADEAWFDEMDAKIKAIVDE
SVKFAEESPWPEASELYTDVYVQKDYPYIRD