Protein Info for ABZR88_RS01325 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: M56 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details PF05569: Peptidase_M56" amino acids 144 to 245 (102 residues), 44.6 bits, see alignment E=1.1e-15 PF03544: TonB_C" amino acids 355 to 428 (74 residues), 54.9 bits, see alignment E=9.8e-19 amino acids 476 to 552 (77 residues), 63.8 bits, see alignment E=1.6e-21 TIGR01352: TonB family C-terminal domain" amino acids 357 to 428 (72 residues), 36.1 bits, see alignment E=3.2e-13 amino acids 477 to 552 (76 residues), 37.9 bits, see alignment E=8.7e-14

Best Hits

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>ABZR88_RS01325 M56 family metallopeptidase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNWWHYLLLANIYLTLFFSFYMLFLRKETFFNLNRVYLVGGAVLSFALPLVQSAWVKQLF
ITQKVQQTILRVDPNAIYQFNVAAMAHTQRQVTLGEVLAAVYGAGILFFFCRFFYQLIQL
QVDILQPKAPSTFSFFNKIRIEESDADNMYITAHEEAHARQWHSADIILIEAITILNWFN
PVVYLYRNAIRHIHEFIADRDALHGGADKAEYAMLLVAQTFHAPPHRMVNPFFNNSMLKE
RIKMLQKNRSARIMLFKYWLSAPLFMLMLILSSATVNNSKAVNAIQNRAQQVFATPAINA
ITNDHSGEIPEEMTAPNNSAQPFNEHSIKDYTALEQTAEFPGGLDAFYAFLAMNMHYPQE
VDAQGKVLVSFIIEKDGALSNFKITQSLAPAFDNEAMRVVKLSPKWHPAVQNGQPIREQF
TVPISFTLFANNNKKPPVVKPAPQPENNNEVFTAVEQSAGFPGGIEAFYRYLSLNIRYPE
EARTHNVQGKVFLTFIVERDGSISNIKLLRGIGSGCDEEAIRVFSNMPKWNPGLQNGYAI
RQQYTVPISFSLVENHTPAPKATTDSTARN