Protein Info for ABZR88_RS01270 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: 30S ribosomal protein S2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR01011: ribosomal protein uS2" amino acids 5 to 226 (222 residues), 313.3 bits, see alignment E=3.6e-98 PF00318: Ribosomal_S2" amino acids 9 to 224 (216 residues), 312 bits, see alignment E=8.2e-98

Best Hits

Swiss-Prot: 67% identical to RS2_CYTH3: 30S ribosomal protein S2 (rpsB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 86% identity to shg:Sph21_1445)

MetaCyc: 50% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>ABZR88_RS01270 30S ribosomal protein S2 (Mucilaginibacter yixingensis YX-36 DSM 26809)
MARTTYQDLLDAGVHFGHLTRKWDPKMAQYIFMERNGIHIIDLNKTVVKLDEAATAIKQI
VKSGRKVLFVATKKQAKDIVADYAKSVNMPFVTERWLGGMLTNFATVRKSIKKMSNIDKL
TKDGTYSNLSKKERLMIQRERIKLESLLGGISDLNRLPAALFLIDVKKEHIAVSEALKLN
IPTFAMVDTNSDPSNIDFPIPANDDATKSISLVTGVIIQAIQEGLEERKRDKEEEAEKEA
VAAKTKVDSNEAAPAEGGKRKRVTADVEAEAVAPAAETEAEGSEE