Protein Info for ABZR88_RS00485 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: 50S ribosomal protein L16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01164: ribosomal protein uL16
  • amino acids 2 to 127 (126 residues), 200.7 bits, E=3.7e-64
• PF00252: Ribosomal_L16
  • amino acids 4 to 132 (129 residues), 191 bits, E=3.8e-61

Best Hits

Swiss-Prot: 80% identical to RL16_PARD8: 50S ribosomal protein L16 (rplP) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02878, large subunit ribosomal protein L16 (inferred from 94% identity to phe:Phep_0609)

MetaCyc: 61% identical to 50S ribosomal subunit protein L16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L16p (L10e)" in subsystem Ribosome LSU bacterial

Protein Sequence (140 amino acids)

>ABZR88_RS00485 50S ribosomal protein L16 (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLQPKRTKFRKMQKGRMKGNASRGAELSFGSFGIKSLEAAWITSRQIEAARIAVTRFMKR
EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRIIFEAEGVPMEVAKEALRL
AAQKLPVQTKFVVRRDYAEA