Protein Info for ABZR88_RS00330 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 33 to 105 (73 residues), 36.6 bits, see alignment E=1.3e-12 PF13715: CarbopepD_reg_2" amino acids 33 to 128 (96 residues), 36 bits, see alignment E=1.5e-12 PF07715: Plug" amino acids 145 to 231 (87 residues), 35.9 bits, see alignment E=2.4e-12 PF00593: TonB_dep_Rec" amino acids 338 to 753 (416 residues), 78.5 bits, see alignment E=2.6e-25 PF14905: OMP_b-brl_3" amino acids 386 to 794 (409 residues), 333 bits, see alignment E=7.7e-103

Best Hits

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (838 amino acids)

>ABZR88_RS00330 TonB-dependent receptor (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNCKPLLKVFSIIFLFGVLSAQAQTNVPVKGAVSGKLVDAASNQPLAFATAALIRKADNT
AAKSIQTDMDGNFKLDNLADGLYLLRTTYVGYGNYVKDSIYISPKKKIFQLGLVKMKQAG
KALKEVTVKAQRSNIQLGVDRKVFNVEQSLVSAGGSATDLLSNVPSVQVDVDGNLNLRGS
SDVRVLINGKPSMLAGASMADILQSIPASSIETIEVITNPSSKYDAEGQSGIVNIVLKKN
ARVGTNGNVAVAVGNQHTYNVSAAVAHQGKNVNLYANYSYRDANRNGNGYTNRTSLRNDT
SILSNQISNQAFTFNSHNIRAGIDISLDPKTTLSFSGNGNFRQRDKYQFGNTNTFTNGVL
TQTLGQNNQAISGTNRNLDFNADFDHKYKKQGEELTANIGYSSEHETSNDSLRSTYNFFN
PASIRERIQHNNSLQKEYNINLQADYTLPLSHNNKIEAGYRSTFSQNDNGNDVDTLQGSG
FVHDGTLTNHFLYKEQVHAVYGTYQQQFGQFGVQGGVRMEEAIINTMVHETGEPHHQDYF
RVYPSLFLTDKLNDNQTLQLSYTRRVSRPRDRQINAFLDKSDPLNWQTGNPLLKPEDTHS
MELSYINYWKALTLTSSLYYRLTNDDIQQIRTPITSTISSLTYQNIKNSQNSGFELIAKV
DASQALDFTANVNAYYRYLQGDASLKLPNSSGFAWNANLTANIKPTKALGVQLRGDYQAP
QVITQGRQRAMAGMDAGLKYDLTKAISLGANVRDVFNSRKFGSITDIVQSPTFSQHSESV
RRFQTRTILFTASYRFGSTPGQRRNRNKDKKDQDNGGGGDDMGQDQGGDGGMSAQRSN