Protein Info for ABIE41_RS24115 in Bosea sp. OAE506

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR00229: PAS domain S-box protein" amino acids 15 to 136 (122 residues), 46.3 bits, see alignment E=2.1e-16 PF08448: PAS_4" amino acids 23 to 131 (109 residues), 41.6 bits, see alignment E=3.8e-14 PF13426: PAS_9" amino acids 27 to 129 (103 residues), 41.4 bits, see alignment E=4.4e-14 PF08447: PAS_3" amino acids 40 to 123 (84 residues), 74.1 bits, see alignment E=2.6e-24 PF07568: HisKA_2" amino acids 143 to 215 (73 residues), 32.3 bits, see alignment E=2.6e-11 PF07536: HWE_HK" amino acids 143 to 230 (88 residues), 53.9 bits, see alignment E=7.8e-18

Best Hits

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABIE41_RS24115 PAS domain-containing protein (Bosea sp. OAE506)
MPDTDLYEAGLPVTEATFKILTDVMPQMVWSTRPDGFHDYYNERWYEFTGVPRGSTDGEG
WAGLFHEEDQPEAWRRWRHSLATGEVYEVEYRLRHNSGQYRWTIGRAQPVRDAQGRIVRW
IGTCTDIHEAKLAAEANELLSHELSHRIKNIFSVVGSLIALSAREFPEAKDFAAQFRERV
SALARAHEFVRPHSEASQPVIGRTTIKGLLENLFSPYPAVSEGRLMVTGEDAAVDDRGAT
PIALLFHELATNAVKYGALSVEAGRIDIAIRQDGGDIAMRWTETGGPPVTGQPGRTGFGT
KLAEMSVGRQLGGRLMRDWRPEGLVVEVVVAAARLARDQDVQP