Protein Info for ABIE41_RS23695 in Bosea sp. OAE506

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13379: NMT1_2
  • amino acids 24 to 244 (221 residues), 61.3 bits, E=1.4e-20
• PF09084: NMT1
  • amino acids 38 to 245 (208 residues), 67.3 bits, E=1.8e-22

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 74% identity to mno:Mnod_0325)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, periplasmic substrate-binding protein" in subsystem Urea decomposition

Protein Sequence (320 amino acids)

>ABIE41_RS23695 ABC transporter substrate-binding protein (Bosea sp. OAE506)
MTGLKRWGTVAGLGLAAALATGGAQAQTKVSIGISGWTGFAPLVLAKEAGIFAKHGLDVT
IKKIPQKDRHLAIASGDIQCAATTVETWIVWDGAGVKTKQIFQLDKSYGADGMVTRNATA
SIKDLKGKTVAASAPGTSPYFALAWFLKENGMSVKDVTVVNMEPGPAAQAFIAGQNDAAM
TYEPYLSAVREKPDAGKIIATTLDYPMVMDTFGCTPAFLAANDAAAAALTKSYFEALDMI
AKEKDKAFGIMGADVKQTGEQFGKSAAFLKWSDAAGNKAFFSGDWQAFSAKAADLLLEIG
LIKTKPDLASLVETKYVAGK