Protein Info for ABIE41_RS23345 in Bosea sp. OAE506

Annotation: gephyrin-like molybdotransferase Glp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 311 to 321 (11 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details PF03453: MoeA_N" amino acids 15 to 177 (163 residues), 146.8 bits, see alignment E=6.8e-47 TIGR00177: molybdenum cofactor synthesis domain" amino acids 188 to 321 (134 residues), 104 bits, see alignment E=3.5e-34 PF00994: MoCF_biosynth" amino acids 190 to 322 (133 residues), 104.9 bits, see alignment E=4.7e-34 PF03454: MoeA_C" amino acids 341 to 410 (70 residues), 53.3 bits, see alignment E=4.1e-18

Best Hits

Swiss-Prot: 41% identical to MOEA_SALTY: Molybdopterin molybdenumtransferase (moeA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 62% identity to mpo:Mpop_2966)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>ABIE41_RS23345 gephyrin-like molybdotransferase Glp (Bosea sp. OAE506)
MAQLSRDDEAFGALMTLEQAGERVAALVAPVSGTETVSLAAADGRVLADAILSPLDLPPF
ANSAVDGYAVHSADLASSGPTRLPLGGRVAAGADAAGLSVRGRAVRVFTGAPMPDGADTV
FMQEDVTLEGEAVLLPPGLARGANARPAGEDIARGALAAAAGQRLRPQDLALLSALGVTQ
VAVRRRPCVAIFSTGDELTEPGQPLRPAAIYDANRALLRAMVARAGAEVVDLGILRDERA
GLAKRLAEAARDCDLVLTSGGVSTGEEDHVKAALEQVGELAFWRIGIKPGRPVALGRIGT
VPFIGLPGNPVAVFVTFAFVARVLIARLAGTAPVAPLSLPVRLGFAYRKKEGRREYVRVS
LEPGPDGVQVARKHPQDGAGVLTSLTRTDGLVELAEDMTRIEEGTLVPFLGYSLLIG