Protein Info for ABIE41_RS23270 in Bosea sp. OAE506

Annotation: MaoC family dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01575: MaoC_dehydratas
  • amino acids 21 to 110 (90 residues), 87.5 bits, E=5.3e-29
• PF03061: 4HBT
  • amino acids 71 to 111 (41 residues), 21.3 bits, E=2.8e-08

Best Hits

Swiss-Prot: 60% identical to CROR_METEA: 3-hydroxybutyryl-CoA dehydratase (croR) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 64% identity to azc:AZC_0033)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• pyruvate fermentation to acetate and lactate II (2/4 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• sulfolactate degradation II (1/4 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• superpathway of taurine degradation (1/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.8

Use Curated BLAST to search for 2.3.1.8

Protein Sequence (147 amino acids)

>ABIE41_RS23270 MaoC family dehydratase (Bosea sp. OAE506)
MTSALYTVHAFEDLTIGMSQSLMRTVMERDVSLFADLSGDANPIHLCDRYAANTKFGQRI
AHGMLTASLVSALLGTRLPGPGAVYLSQTLTFLAPVKIGDVVTARVEVMELVAERRRARL
FCECLVDGKAVLEGEAWVALPPARPRG