Protein Info for ABIE41_RS22920 in Bosea sp. OAE506

Annotation: aminomethyl-transferring glycine dehydrogenase subunit GcvPA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF02347: GDC-P" amino acids 1 to 401 (401 residues), 387.5 bits, see alignment E=4.3e-120

Best Hits

Swiss-Prot: 75% identical to GCSPA_AZOC5: Probable glycine dehydrogenase (decarboxylating) subunit 1 (gcvPA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00282, glycine dehydrogenase subunit 1 [EC: 1.4.4.2] (inferred from 77% identity to pgv:SL003B_3376)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>ABIE41_RS22920 aminomethyl-transferring glycine dehydrogenase subunit GcvPA (Bosea sp. OAE506)
MRYLPLTDTDREDMLARIGVADVDALFSDVPADKLLKAPVDLPRARGELEVERIMAKMSA
RNVAASSVPFFVGAGAYKHHVPATVDHLIQRSEFLTSYTPYQPEIAQGTLQYLFEFQTQV
AALTGMEVANASMYDGSTGTGEAVLMAHRVTKRKKAVLSGGLHPHYAQVVRTLSEMANDQ
VVTMPPDVAAGEDILSRIDDETSCVVVQNPDVFGNLRDLRPIAAKAHAHGALLIAVFTEV
VSLGAIVPPGAQDADIVVGEGQSIGNALNFGGPYVGLFAAKSKYIRQMPGRLCGETVDAA
GQRGFVLTLSTREQHIRRDKATSNICTNSGLCCLAFTIHMTLLGQAGLERLAEVNHANAV
ALADALAAVRGVTVLNESFFNEFTVKLPRPAAEVVEALAAKGILGGVPVSRLLPQAGLDD
LLLVASTEVNTNEDRAAFVAALAEVL