Protein Info for ABIE41_RS22785 in Bosea sp. OAE506

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 98 to 267 (170 residues), 187.5 bits, see alignment E=8.2e-60 PF03167: UDG" amino acids 112 to 260 (149 residues), 122 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 58% identity to rpc:RPC_4359)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>ABIE41_RS22785 uracil-DNA glycosylase (Bosea sp. OAE506)
MSLTAAPDPAELVAWYAEMGITEALDEVTHDHFAAPVASEPTRPRPVLPPRAGQPALVAV
RPNAAAATAPDDAALSARSLAQEAATLEALKEALARFEGCALKATAKSLVFADGNSNGRV
MIVGEAPGADEDRIGLPFVGRSGQLLDRMLAAIGLSRKDDVYIANLLPWRPPGNRTPTPQ
EVAICLPFIQRQIQLADPDILLCIGGPSAQGLLGLSGILASRGKWQEYDTGTRRIPAMAT
LHPAYLLRQPLQKRLAWRDMRALKAALDKAP