Protein Info for ABIE41_RS22700 in Bosea sp. OAE506

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 8 to 212 (205 residues), 273.3 bits, E=6.3e-86
• PF14681: UPRTase
  • amino acids 10 to 212 (203 residues), 252.9 bits, E=2.1e-79
• PF00156: Pribosyltran
  • amino acids 69 to 174 (106 residues), 39.6 bits, E=3.4e-14

Best Hits

Swiss-Prot: 70% identical to UPP_RHILW: Uracil phosphoribosyltransferase (upp) from Rhizobium leguminosarum bv. trifolii (strain WSM2304)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 79% identity to mch:Mchl_1827)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (213 amino acids)

>ABIE41_RS22700 uracil phosphoribosyltransferase (Bosea sp. OAE506)
MTKQQDGVTVVDHPLVQHKLTLMRQKDRSTKSFRQLLNEIGMLLCYEVTRDLPVEMIEIE
TPLQTSLQPVISGKKMVFAPILRAGVGFLDGMLELVPAARVAHIGLYRDPDTLQAVEYYF
KAPSDIADRMIVVMDPMLATANSAVAAIDRLKERGAKDLRFVCLLAAPEGIERLRGAHPE
VRIWTAAIDEKLNDHGYIVPGLGDAGDRMFGTR