Protein Info for ABIE41_RS22655 in Bosea sp. OAE506

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 288 to 308 (21 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 395 to 423 (29 residues), see Phobius details amino acids 436 to 460 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 29 to 460 (432 residues), 323.7 bits, see alignment E=9.3e-101 PF03448: MgtE_N" amino acids 32 to 131 (100 residues), 60.5 bits, see alignment E=3.1e-20 PF00571: CBS" amino acids 205 to 253 (49 residues), 40.7 bits, see alignment 3.6e-14 PF01769: MgtE" amino acids 322 to 454 (133 residues), 128.9 bits, see alignment E=2.1e-41

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 67% identity to mno:Mnod_4800)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABIE41_RS22655 magnesium transporter (Bosea sp. OAE506)
MNEIVDRDTIRGASVPADLLAHTLAASLASEHVADIVETLEDQGARSAAAILLALPFERA
VEVLDEPAFETAPAVLALLPEERAAAFLDAMSADRVTDVLARTDGPARARLLRRLDAPTH
AAVTRLLTYPEGSAGSLMTTEFVSVPADWTVAQTLRHIGTVERSRETVYSIYVRDPASGV
LLHAVPLRRLLSGDPGAAITTLAPAHKPVTVTPGADREDVARLISKYNLLAVPVVDVAGH
VIGIVTVDDVIDTMIAETTEDVQKLGGMEALNERYDQIGFLTMIRKRAGWLSILLVGEML
TASAMQVFEAELEKAIVLALFIPLIMSSGGNSGSQATSLIIRALALREISLKDWWRVALR
ELPTGMTLGAILGAIGIARIVAWQKLGLYDYGPHWLLVAATIGATLVCIVTFGSLTGSML
PFVLKRLGFDPASASAPFVATLVDVTGLVIYFGVAAAILTGTLL