Protein Info for ABIE41_RS22555 in Bosea sp. OAE506

Annotation: ceramide glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 45 to 270 (226 residues), 44.4 bits, see alignment E=2.8e-15 PF13506: Glyco_transf_21" amino acids 103 to 270 (168 residues), 187.1 bits, see alignment E=2.9e-59 PF13632: Glyco_trans_2_3" amino acids 131 to 318 (188 residues), 32.8 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K00720, ceramide glucosyltransferase [EC: 2.4.1.80] (inferred from 57% identity to mci:Mesci_5983)

Predicted SEED Role

"Ceramide glucosyltransferase (EC 2.4.1.80)" (EC 2.4.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABIE41_RS22555 ceramide glucosyltransferase (Bosea sp. OAE506)
MSAAGWAGLFAVLLVATNLLCQAIAYARLRRADRRTPLLAALPPVTIVRPLRGIEAFSRE
TAISGLELDYPDYVTIFAVADADDPIVLLVEELIARYGAERVKLMTGDVKVSANPKLNNC
VKGWEAAQTEWVILADSNVLMPKDYIQRLLASWRDDTGLVCSTPAGSRPFGFWAELECAF
LNTFQARWQFAGEACGFGFAQGKSMLWNKPFLDARGGIAALGEEIAEDAAATKLVRRAGK
HVHLVGQPFEQPLGERSLSDVVQRQFRWARLRRVTFLPFFLPEILSGPLLAVLAAAVALP
AFGLSAWLAPVLVLLPWYVAELAFARGVGWYGSWRMPLALLVRDIVFPGVWAYAFVAGEV
SWRGNAMKIKTDGEDELNAAPAPMSHAMTRSDGRS