Protein Info for ABIE41_RS22380 in Bosea sp. OAE506

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF00270: DEAD" amino acids 26 to 196 (171 residues), 167.7 bits, see alignment E=2.8e-53 PF04851: ResIII" amino acids 26 to 191 (166 residues), 29 bits, see alignment E=1.4e-10 PF00271: Helicase_C" amino acids 232 to 340 (109 residues), 101.4 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: None (inferred from 53% identity to rpb:RPB_1793)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>ABIE41_RS22380 DEAD/DEAH box helicase (Bosea sp. OAE506)
MTQFTDLGLAEQLLKALASEGYTTPTPIQAQAIPPILQGRDLLGAAQTGTGKTAAFSLPL
IHRLLSQPRRMETRSVRALILSPTRELAAQIETSIRAYAQFTTIKSAVIFGGVPVGKQIR
ALGQHVDILVATPGRLLDLVDQRAVSLREIEYLVLDEADQMLDLGFVHALRRIATLIPKK
RQTLLFSATMPKPIREIASAYLSDPVEVSVAPVATTAEKIDQRVIFTNPADKPSLLAKTL
SVPEMERAIVFTRTKHGADKVVRQLEVSGIKSAAIHGNKSQGQRERALGAFRDGELRILV
ATDIAARGIDVDGISHVVQFDLPNVAETYVHRIGRTARAGASGVAIAFCTPEERGDLAAI
EKLTRIAITPVGDVPYWDGRTPKKPPQNQGRGGRGQQGGGGRDQGRPQGERSGRPQSAKP
AHAGAARSEAPRNDRPQRAEPQGQRKDAGSAKEGLGGVAFLQQRTQQPRTNGARRRAN