Protein Info for ABIE41_RS22080 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 135 (125 residues), 38 bits, see alignment E=8.9e-14 amino acids 148 to 278 (131 residues), 46 bits, see alignment E=3e-16

Best Hits

KEGG orthology group: None (inferred from 50% identity to met:M446_1767)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>ABIE41_RS22080 DMT family transporter (Bosea sp. OAE506)
MSLGPALRALLGIALLTAMDGVVKAQMQSHPFIVALFMRFAMGGVCALAVLAILRPPAPT
RASVIGNSIRVPVVVLTAGSFFYSISVLPLAEALTLAFLAPVFVALLGGLLLKEKMDAPI
WQALGFGVAGMLVMVWPRLQGQVSGAGLGVAAALFSAVTYAFNLILLRRIALKEHPAVIV
AFQNCGPALLLAVPAALAFVPLTGRDVLIYLAAGALGVAGHLLLTSAFAKAEASRLAPLE
YTALIWASLLGYAFFDEVPLITTYAGAVLIVAGAIAISRR