Protein Info for ABIE41_RS22020 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 54.1 bits, see alignment E=1.7e-18 PF00528: BPD_transp_1" amino acids 113 to 312 (200 residues), 149.5 bits, see alignment E=9.4e-48

Best Hits

Swiss-Prot: 58% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 80% identity to bra:BRADO3020)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABIE41_RS22020 ABC transporter permease (Bosea sp. OAE506)
MLAFIVRRIITTIPVMAFVALFVFSLLYVAPGDPAAVIAGDQASPADVERIRASLGLDRP
YLVRFAEWSFRVLQGDLGTSIFTSLPVTQLIAQRIEPTLSLMVLTLIFAVSIAVPMGVIA
AWKAGTWIDRGAMAFAVFGFSVPVFVVGYLLAYVFALQLDWVPVQGYTPLSQGFWPWFRN
LILPAMTLGLVYIALIARITRATMLEVLQQDYVRTAQAKGVGQREVLFLHALKNAAVPIV
TIIGIGIALLIGGAVVTESVFAIPGLGRLTVDAILRRDYPVIQGVVLMFSLVYVLVNLLI
DLTYTIVDPRIRY